PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_072720_ohdu.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 303aa    MW: 32837 Da    PI: 6.6294
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_072720_ohdu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.86.6e-32176232158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQy++Il+RRq Rak+e e+kl +k rkpylheSRh+hAlrR+Rg+gGrF
  Bv4_072720_ohdu.t1 176 QEPVYVNAKQYHGILRRRQVRAKAELERKL-IKIRKPYLHESRHQHALRRARGTGGRF 232
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.4E-35174235IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.071175235IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-26177232IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-24178200IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.9E-24209232IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MPSKSILANQ PEPSSHTTTP PSAVCSEQWW RTAGYGQFPI TDAGGNALKH TLLDNPVEMS  60
GSKDDQSLSN AGDDEDETSK DSETTGSTST PRDGSSGHEL HKSQYGESSM SLGSGDYFSQ  120
HPQLELVGHS IACASTPYPD LYYGGMMAAY GPQPLVPPQF YGMHQPRMPL PLEMAQEPVY  180
VNAKQYHGIL RRRQVRAKAE LERKLIKIRK PYLHESRHQH ALRRARGTGG RFAKKGEAEG  240
SSHSAEEGNK NSDAGGSRSH ETRDEHADIS NGSGGTRAGE GQSNQQWGNG MSTDQAPQCA  300
LAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18176232258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673645.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLA0A0J8CLA30.0A0A0J8CLA3_BETVU; Uncharacterized protein
STRINGGLYMA18G07890.23e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.17e-53nuclear factor Y, subunit A9